Loading...
Statistics
Nai Davina – Yoga
www.naidavina.com/
Naidavina.com
Naidavina.com is hosted in
United Kingdom
.
Naidavina.com uses HTTPS protocol.
Number of used technologies:
12.
First technologies:
CSS, Flexslider, Google Font API,
Number of used javascripts: 19.
First javascripts:
Greensock.js, Jquery.js, Jquery-migrate.min.js,
Number of used analytics tools:
0.
Number of used plugins, modules: 5.
Its server type is:
Apache.
Its CMS is:
Wordpress.
Technologies in use by Naidavina.com
Technology
Number of occurences: 12
- CSS
- Flexslider
- Google Font API
- Html
- Html5
- Javascript
- jQuery
- jQuery UI
- Php
- Pingback
- Revslider
- Shortcodes
Advertisement
Javascripts
Number of occurences: 19
- greensock.js
- jquery.js
- jquery-migrate.min.js
- layerslider.kreaturamedia.jquery.js
- layerslider.transitions.js
- jquery.themepunch.tools.min.js
- jquery.themepunch.revolution.min.js
- front-end.js
- jquery.form.min.js
- scripts.js
- core.min.js
- widget.min.js
- mouse.min.js
- slider.min.js
- sortable.min.js
- effect.min.js
- total-min.js
- wp-embed.min.js
- js_composer_front.min.js
Content Management System
Number of occurences: 1
- Wordpress
Server Type
- Apache
Powered by
- PleskLin
Used plugins, modules
Number of plugins and modules: 5
- LayerSlider
- revslider
- soundy background music
- contact form 7
- js composer
Conversion rate optimization |
|
|---|---|
Clickable call number
|
Not founded! |
|
Conversion form (contact form, subcriber)
|
Founded! |
|
Clickable email
|
Founded! |
|
CTA (call to action) button
|
Founded! |
|
List
|
Founded! |
|
Image
|
Not founded! |
|
Enhancement
|
Not founded! |
|
Responsive website
|
Founded! |
|
Facebook sharing
|
Not founded! |
|
Google+ sharing
|
Not founded! |
|
Twitter sharing
|
Not founded! |
|
Linkedin sharing
|
Not founded! |
|
Blog on the webiste
|
Not founded! |
HTTPS (SSL) - Naidavina.com
SSL certificate
- name: /OU=GT55182271/OU=See www.rapidssl.com/resources/cps (c)15/OU=Domain Control Validated - RapidSSL(R)/CN=www.ukc02.uk
- subject:
- OU:
- 0: GT55182271
- 1: See www.rapidssl.com/resources/cps (c)15
- 2: Domain Control Validated - RapidSSL(R)
- CN: www.ukc02.uk
- OU:
- hash: 614b01ce
- issuer:
- C: US
- O: GeoTrust Inc.
- CN: RapidSSL SHA256 CA - G3
- version: 2
- serialNumber: 383295
- validFrom: 150721033116Z
- validTo: 180722231402Z
- validFrom_time_t: 1437449476
- validTo_time_t: 1532301242
- extensions:
- authorityKeyIdentifier: keyid:C3:9C:F3:FC:D3:46:08:34:BB:CE:46:7F:A0:7C:5B:F3:E2:08:CB:59
- authorityInfoAccess: OCSP - URI:http://gv.symcd.com CA Issuers - URI:http://gv.symcb.com/gv.crt
- keyUsage: Digital Signature, Key Encipherment
- extendedKeyUsage: TLS Web Server Authentication, TLS Web Client Authentication
- subjectAltName: DNS:www.ukc02.uk, DNS:ukc02.uk
- crlDistributionPoints: Full Name: URI:http://gv.symcb.com/gv.crl
- basicConstraints: CA:FALSE
- certificatePolicies: Policy: 2.23.140.1.2.1 CPS: https://www.rapidssl.com/legal
Number of occurences: 3
- Name:
Content: - Name: viewport
Content: width=device-width, initial-scale=1 - Name: generator
Content: Powered by Slider Revolution 5.2.4.1 - responsive, Mobile-Friendly Slider Plugin for WordPress with comfortable drag and drop interface.
Server / Hosting
- IP: 5.77.35.132
- Latitude: 51.50
- Longitude: -0.12
- Country: United Kingdom
Rname
- ns.ukc02.uk
- ns2.ukc02.uk
- mail.naidavina.com
Target
- shokka9.hotmail.com
HTTP Header Response
HTTP/1.1 301 Moved Permanently
Date: Thu, 22 Sep 2016 01:23:50 GMT
Server: Apache
X-UA-Compatible: IE=edge
Location: http://naidavina.com/
X-Powered-By: PleskLin
Content-Length: 0
Content-Type: text/html; charset=UTF-8
X-Cache: MISS from s_hv897
Via: 1.1 s_hv897 (squid/3.5.20)
Connection: keep-alive
HTTP/1.1 200 OK
Date: Thu, 22 Sep 2016 01:23:51 GMT
Server: Apache
X-UA-Compatible: IE=edge
Link: ; rel="https://api.w.org/", ; rel=shortlink
X-Powered-By: PleskLin
Content-Type: text/html; charset=UTF-8
X-Cache: MISS from s_hv897
Transfer-Encoding: chunked
Via: 1.1 s_hv897 (squid/3.5.20)
Connection: keep-alive
DNS
host: naidavina.com
- class: IN
- ttl: 86400
- type: A
- ip: 5.77.35.132
host: naidavina.com
- class: IN
- ttl: 86400
- type: NS
- target: ns.ukc02.uk
host: naidavina.com
- class: IN
- ttl: 86400
- type: NS
- target: ns2.ukc02.uk
host: naidavina.com
- class: IN
- ttl: 86400
- type: SOA
- mname: ns.ukc02.uk
- rname: shokka9.hotmail.com
- serial: 1457117432
- refresh: 10800
- retry: 3600
- expire: 604800
- minimum-ttl: 10800
host: naidavina.com
- class: IN
- ttl: 86400
- type: MX
- pri: 10
- target: mail.naidavina.com
host: naidavina.com
- class: IN
- ttl: 86400
- type: TXT
- txt: v=spf1 a mx ip4:5.77.35.132 ip4:5.77.35.133 mx:mail.ukc02.uk mx:mail.naidavina.com ~all
- entries: Array
Common Typos/Mistakes
This list shows You some spelling mistakes at internet search for this domain.
www.aidavina.com, www.nnaidavina.com, www.naidavina.com, www.nhaidavina.com, www.haidavina.com, www.njaidavina.com, www.jaidavina.com, www.nkaidavina.com, www.kaidavina.com, www.nlaidavina.com, www.laidavina.com, www.n aidavina.com, www. aidavina.com, www.nidavina.com, www.naoidavina.com, www.noidavina.com, www.napidavina.com, www.npidavina.com, www.na9idavina.com, www.n9idavina.com, www.naidavina.com, www.nidavina.com, www.naiidavina.com, www.niidavina.com, www.nauidavina.com, www.nuidavina.com, www.nadavina.com, www.nairdavina.com, www.nardavina.com, www.naifdavina.com, www.nafdavina.com, www.naivdavina.com, www.navdavina.com, www.naikdavina.com, www.nakdavina.com, www.nai,davina.com, www.na,davina.com, www.naibdavina.com, www.nabdavina.com, www.naigdavina.com, www.nagdavina.com, www.naitdavina.com, www.natdavina.com, www.naiydavina.com, www.naydavina.com, www.naiudavina.com, www.naudavina.com, www.naijdavina.com, www.najdavina.com, www.naimdavina.com, www.namdavina.com, www.naindavina.com, www.nandavina.com, www.naiavina.com, www.naidtavina.com, www.naitavina.com, www.naidgavina.com, www.naigavina.com, www.naidbavina.com, www.naibavina.com, www.naidxavina.com, www.naixavina.com, www.naidsavina.com, www.naisavina.com, www.naidfavina.com, www.naifavina.com, www.naidvavina.com, www.naivavina.com, www.naidyavina.com, www.naiyavina.com, www.naidzavina.com, www.naizavina.com, www.naidaavina.com, www.naiaavina.com, www.naideavina.com, www.naieavina.com, www.naidravina.com, www.nairavina.com, www.naidvina.com, www.naidaovina.com, www.naidovina.com, www.naidapvina.com, www.naidpvina.com, www.naida9vina.com, www.naid9vina.com, www.naidavina.com, www.naidvina.com, www.naidaivina.com, www.naidivina.com, www.naidauvina.com, www.naiduvina.com, www.naidaina.com, www.naidavyina.com, www.naidayina.com, www.naidavzina.com, www.naidazina.com, www.naidavhina.com, www.naidahina.com, www.naidavnina.com, www.naidanina.com, www.naidavmina.com, www.naidamina.com, www.naidavjina.com, www.naidajina.com, www.naidavkina.com, www.naidakina.com, www.naidaviina.com, www.naidaiina.com, www.naidavna.com, www.naidavirna.com, www.naidavrna.com, www.naidavifna.com, www.naidavfna.com, www.naidavivna.com, www.naidavvna.com, www.naidavikna.com, www.naidavkna.com, www.naidavi,na.com, www.naidav,na.com, www.naidavibna.com, www.naidavbna.com, www.naidavigna.com, www.naidavgna.com, www.naidavitna.com, www.naidavtna.com, www.naidaviyna.com, www.naidavyna.com, www.naidaviuna.com, www.naidavuna.com, www.naidavijna.com, www.naidavjna.com, www.naidavimna.com, www.naidavmna.com, www.naidavinna.com, www.naidavnna.com, www.naidavia.com, www.naidavinna.com, www.naidavina.com, www.naidavinha.com, www.naidaviha.com, www.naidavinja.com, www.naidavija.com, www.naidavinka.com, www.naidavika.com, www.naidavinla.com, www.naidavila.com, www.naidavin a.com, www.naidavi a.com, www.naidavin.com, www.naidavinao.com, www.naidavino.com, www.naidavinap.com, www.naidavinp.com, www.naidavina9.com, www.naidavin9.com, www.naidavina.com, www.naidavin.com, www.naidavinai.com, www.naidavini.com, www.naidavinau.com, www.naidavinu.com,
Other websites we recently analyzed
- Steven Lange Books |
Houston (United States) - 192.232.219.69
Server software: nginx/1.10.0
Technology: CSS, Datepicker, Flexslider, Google Font API, Gravatar, Html, Html5, Iframe, Javascript, jQuery, jQuery UI, Php, Pingback, Revslider, Shortcodes, Google Analytics, Wordpress, Facebook Like button, Facebook Box, Twitter Button
Number of Javascript: 39
Number of meta tags: 5 - null
Korea, Republic of - 211.241.100.47
Server software:
Technology: Html, Javascript
Number of meta tags: 3 - howsyoursoil.com
Wayne (United States) - 216.250.120.153
Server software: squid/3.5.14
Technology: Html
Number of meta tags: 3 - Best Buy Travels & Tours
Tempe (United States) - 69.160.32.58
Server software: nginx admin
Technology: Maxcdn, OSS CDN, CSS, Font Awesome, Google Font API, Html, Html5, jQuery
Number of Javascript: 2
Number of meta tags: 4 - San Diego Employment Law And Business Law Attorney | Palm Springs CA
Contact Donald R. Holben & Associates, APC, in San Diego, California, at 619-780-2820 for legal advice and representation.Europe - 2.20.188.249
Server software: Apache
Technology: CSS, Google Font API, Html, Html5, Javascript, Php, Omniture, SiteCatalyst
Number of Javascript: 9
Number of meta tags: 16 - Angela Mercedes Donna Otto's Portfolio
Germany - 89.107.184.29
Server software: nginx/1.2.1
Technology: CSS, Html, Javascript, Google Analytics
Number of Javascript: 2
Number of meta tags: 1 - ÐÑÑÐ¾Ñ†Ð¸Ð°Ñ†Ð¸Ñ Ñлужб такÑи роÑÑийÑкой федерации
Nürnberg (Germany) - 88.198.0.162
Server software: nginx/1.8.1
Technology: Maxcdn, OSS CDN, CSS, Html, Html5, Javascript, jQuery, Yandex.Metrika
Number of Javascript: 4
Number of meta tags: 2 - AWAY REALTY | Лучшее агентÑтво зарубежной недвижимоÑти
HOMES.RU - AWAY REALTY: ÐÐ»Ð¸Ñ‚Ð½Ð°Ñ Ð·Ð°Ñ€ÑƒÐ±ÐµÐ¶Ð½Ð°Ñ Ð½ÐµÐ´Ð²Ð¸Ð¶Ð¸Ð¼Ð¾ÑÑ‚ÑŒ, ÑÐ»Ð¸Ñ‚Ð½Ð°Ñ Ð½ÐµÐ´Ð²Ð¸Ð¶Ð¸Ð¼Ð¾ÑÑ‚ÑŒ за рубежом, продажа домов за рубежом, квартира, апартаменты, вилла, пентхауÑ, коттедж, таунхауÑ, оÑобнÑк, дача, бунгало, офиÑ, землÑ, земельный учаÑток, Ñтраны мира, Европа, оÑтрова, Ñкзотика, Ð¿Ñ€Ð°Ð²Ð¾Ð²Ð°Ñ Ð¸Ð½Ñ„Ð¾Ñ€Ð¼Ð°Ñ†Ð¸Ñ, визы, опиÑание Ñтраны по недвижимоÑти, ÐвÑтриÑ, ВеликобританиÑ, ГерманиÑ, ИÑпаниÑ, ИталиÑ, ПортугалиÑ, ФранциÑ, ХорватиÑ, ЧерногориÑ.Netherlands - 109.206.190.54
Server software: nginx/1.10.1
Technology: CSS, Html, Html5, Javascript, jQuery, Php, Yandex.Metrika
Number of Javascript: 4
Number of meta tags: 5 - sariyerevdenevenakliyatfirmalari.com | Isimtescil.net | Ücretsiz yapım aşamasında sayfası
Cyprus - 93.89.226.17
Server software: Microsoft-IIS/7.5
Technology: CSS, Html - Riverlands Equestrian - Welcome
Riverlands Equestrian FacilitySan Francisco (United States) - 199.34.228.58
Server software: Apache
Technology: CSS, Html, Html5, Javascript, Google Analytics, Quantcast Measurement, Webly
Number of Javascript: 5
Number of meta tags: 4